scytek logo
 
  • COMPANY
    • ABOUT US
    • CONTACT US
  • Products
    • Enzyme Immunoassay
    • Immunohistochemistry
    • Antibodies
    • DNA Ploidy Analysis
    • Histology
    • Cytology
    • Hematology
    • Microbiology
    • Buffers
  • KNOWLEDGE
DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DG1/447 & DOG-1.1 (Concentrate)
DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DG1/447 & DOG-1.1 (Concentrate)

DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DG1/447 & DOG-1.1 (Concentrate)

Species: Mouse
Immunogen: Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
Clone: DG1/447 & DOG-1.1
Isotype: IgG1, kappa (DG1/447 & DOG-1.1)
Species Reactivity: Human. Others not known.
Positive Control: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Specificity: This monoclonal antibody recognizes Human DOG1. It is a sensitive and specific immunohistochemical marker for GIST, comparable with c-Kit, with the additional benefit of detecting c-Kit-negative GISTs. It is also a sensitive marker for unusual GIST subgroups lacking c-Kit or PDGFRA mutations.
Status: RUO

 IFU - US  |  SDS 

Select size

Quantity
Add to cart

Company

  • Company Profile
  • Awards/Certificates
  • Careers
  • OEM/Private Label

Support

  • SDS
  • Technical Support
  • Consulting Services
  • Industry Links

Contact

  • Contact Us
  • Global Distributors
  • Sales
 

Social media links

Privacy Policy | Terms and Conditions | Refund Policy 

© 2017, ScyTek Laboratories, Inc. 205 South 600 West Logan, UT 84321, 800-729-8350 | scytek@scytek.com