DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DOG-1.1 (Concentrate)
					
						
						Species:  	Mouse
Immunogen:  	A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
Clone:  	DOG-1.1
Isotype:  	IgG1, kappa
Species Reactivity:  	Human. Others not known.
Positive Control:  	Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Specificity:  	DOG1.1 is a sensitive and specific immunohistochemical marker for GIST, comparable with c-Kit, with the additional benefit of detecting c-Kit-negative GISTs. DOG1.1 is also a sensitive marker for unusual GIST subgroups lacking c-Kit or PDGFRA mutations. 
Status:  RUO